Lineage for d2n18b_ (2n18 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719846Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1719847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
    Uniprot P00044
  8. 1719909Domain d2n18b_: 2n18 B: [272659]
    Other proteins in same PDB: d2n18a_
    automated match to d1s6vb_
    complexed with hec, hem

Details for d2n18b_

PDB Entry: 2n18 (more details)

PDB Description: dominant form of the low-affinity complex of yeast cytochrome c and cytochrome c peroxidase
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d2n18b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n18b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmcfgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d2n18b_:

Click to download the PDB-style file with coordinates for d2n18b_.
(The format of our PDB-style files is described here.)

Timeline for d2n18b_:

  • d2n18b_ appears in periodic updates to SCOPe 2.05 starting on 2015-05-13
  • d2n18b_ is called d2n18b1 in SCOPe 2.06
  • d2n18b_ appears in the current release, SCOPe 2.07, called d2n18b1