![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Odorant-binding protein [50821] (2 species) C-termini swapping dimer |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50822] (8 PDB entries) |
![]() | Domain d1obpa_: 1obp A: [27092] complexed with unx |
PDB Entry: 1obp (more details), 2 Å
SCOPe Domain Sequences for d1obpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obpa_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]} qeeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrd gkwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvk lnvededlekfwkltedkgidkknvvnflenedhphpe
Timeline for d1obpa_: