Lineage for d1obpa_ (1obp A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395398Family b.60.1.1: Retinol binding protein-like [50815] (22 protein domains)
    barrel, closed; n=8, S=12, meander
  6. 2395769Protein Odorant-binding protein [50821] (2 species)
    C-termini swapping dimer
  7. 2395770Species Cow (Bos taurus) [TaxId:9913] [50822] (8 PDB entries)
  8. 2395771Domain d1obpa_: 1obp A: [27092]
    complexed with unx

Details for d1obpa_

PDB Entry: 1obp (more details), 2 Å

PDB Description: odorant-binding protein from bovine nasal mucosa
PDB Compounds: (A:) odorant-binding protein

SCOPe Domain Sequences for d1obpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obpa_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]}
qeeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrd
gkwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvk
lnvededlekfwkltedkgidkknvvnflenedhphpe

SCOPe Domain Coordinates for d1obpa_:

Click to download the PDB-style file with coordinates for d1obpa_.
(The format of our PDB-style files is described here.)

Timeline for d1obpa_: