Lineage for d1obpa_ (1obp A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16457Family b.60.1.1: Retinol binding protein-like [50815] (12 protein domains)
  6. 16530Protein Odorant-binding protein [50821] (2 species)
  7. 16531Species Cow (Bos taurus) [TaxId:9913] [50822] (2 PDB entries)
  8. 16532Domain d1obpa_: 1obp A: [27092]

Details for d1obpa_

PDB Entry: 1obp (more details), 2 Å

PDB Description: odorant-binding protein from bovine nasal mucosa

SCOP Domain Sequences for d1obpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obpa_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus)}
qeeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrd
gkwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvk
lnvededlekfwkltedkgidkknvvnflenedhphpe

SCOP Domain Coordinates for d1obpa_:

Click to download the PDB-style file with coordinates for d1obpa_.
(The format of our PDB-style files is described here.)

Timeline for d1obpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1obpb_