PDB entry 1obp

View 1obp on RCSB PDB site
Description: odorant-binding protein from bovine nasal mucosa
Class: odorant-binding protein
Keywords: olfaction, nose, transport, lipocalin, odorant-binding protein
Deposited on 1996-01-14, released 1996-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant-binding protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07435 (Start-158)
      • conflict (116)
    Domains in SCOPe 2.08: d1obpa_
  • Chain 'B':
    Compound: odorant-binding protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07435
      • conflict (116)
    Domains in SCOPe 2.08: d1obpb_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1obpA (A:)
    aqeeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkr
    dgkwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfv
    klnvededlekfwkltedkgidkknvvnflenedhphpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1obpA (A:)
    qeeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrd
    gkwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvk
    lnvededlekfwkltedkgidkknvvnflenedhphpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1obpB (B:)
    aqeeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkr
    dgkwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfv
    klnvededlekfwkltedkgidkknvvnflenedhphpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1obpB (B:)
    eeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdg
    kwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvkl
    nvededlekfwkltedkgidkknvvnflenedhph