SCOPe 2.07: Domain d1obpa_: 1obp A:

Lineage for d1obpa_ (1obp A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Odorant-binding protein [50821] (2 species)
   C-termini swapping dimer

7. Species Cow (Bos taurus) [TaxId:9913] [50822] (8 PDB entries)

8. Domain d1obpa_: 1obp A: [27092]
   complexed with unx

Details for d1obpa_

PDB Entry: 1obp, 2 Å

PDB Description: odorant-binding protein from bovine nasal mucosa

PDB Compounds: (A:) odorant-binding protein

SCOPe Domain Sequences for d1obpa_:

Sequence; same for both SEQRES and ATOM records:

>d1obpa_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]}
qeeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrd
gkwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvk
lnvededlekfwkltedkgidkknvvnflenedhphpe

Timeline for d1obpa_:

• d1obpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1obpa_ appears in SCOPe 2.06
  
• d1obpa_ appears in the current release, SCOPe 2.08