Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries) |
Domain d4x1id2: 4x1i D:246-441 [270811] Other proteins in same PDB: d4x1ia1, d4x1ib1, d4x1ic1, d4x1id1, d4x1ie_ automated match to d3rycd2 complexed with 3wd, gdp, gtp, loc, mg |
PDB Entry: 4x1i (more details), 3.11 Å
SCOPe Domain Sequences for d4x1id2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x1id2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
Timeline for d4x1id2: