Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (9 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries) |
Domain d4x1id1: 4x1i D:2-245 [270810] Other proteins in same PDB: d4x1ia2, d4x1ib2, d4x1ic2, d4x1id2, d4x1ie_ automated match to d4drxb1 complexed with 3wd, gdp, gtp, loc, mg |
PDB Entry: 4x1i (more details), 3.11 Å
SCOPe Domain Sequences for d4x1id1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x1id1 c.32.1.1 (D:2-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
Timeline for d4x1id1: