![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries) |
![]() | Domain d4x1ia2: 4x1i A:246-437 [270813] Other proteins in same PDB: d4x1ia1, d4x1ib1, d4x1ic1, d4x1id1, d4x1ie_ automated match to d4i50a2 complexed with 3wd, gdp, gtp, loc, mg |
PDB Entry: 4x1i (more details), 3.11 Å
SCOPe Domain Sequences for d4x1ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x1ia2 d.79.2.1 (A:246-437) automated matches {Sheep (Ovis aries) [TaxId: 9940]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgv
Timeline for d4x1ia2: