Lineage for d4x1ie_ (4x1i E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2734111Domain d4x1ie_: 4x1i E: [270809]
    Other proteins in same PDB: d4x1ia1, d4x1ia2, d4x1ib1, d4x1ib2, d4x1ic1, d4x1ic2, d4x1id1, d4x1id2
    automated match to d3ryce_
    complexed with 3wd, gdp, gtp, loc, mg

Details for d4x1ie_

PDB Entry: 4x1i (more details), 3.11 Å

PDB Description: discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d4x1ie_:

Sequence, based on SEQRES records: (download)

>d4x1ie_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqeael
lkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdk
haeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d4x1ie_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ielnkatsgqswevilkppsfdgvpepsleeiqkkleaaeerrkyqeaellkhlaekreh
ereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknke
lke

SCOPe Domain Coordinates for d4x1ie_:

Click to download the PDB-style file with coordinates for d4x1ie_.
(The format of our PDB-style files is described here.)

Timeline for d4x1ie_: