PDB entry 4x1i

View 4x1i on RCSB PDB site
Description: Discovery of cytotoxic Dolastatin 10 analogs with N-terminal modifications
Class: structural protein/inhibitor
Keywords: Binding Sites, Competitive, Cattle, Tumor, Colchicine, Humans, Microtubules, Protein Binding, Protein Conformation, Protein Multimerization, Tubulin, Tubulin Modulators, STRUCTURAL PROTEIN-INHIBITOR complex
Deposited on 2014-11-24, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x1ia1, d4x1ia2
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x1ib1, d4x1ib2
  • Chain 'C':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x1ic1, d4x1ic2
  • Chain 'D':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x1id1, d4x1id2
  • Chain 'E':
    Compound: Stathmin-4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STMN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63043
      • engineered mutation (10)
      • engineered mutation (16)
    Domains in SCOPe 2.07: d4x1ie_
  • Heterogens: GTP, MG, GDP, LOC, 3WD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x1iA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1iA (A:)
    recisihvgqagvqignacwelyclehgiqpdgqmpsddsfntffsetgagkhvpravfv
    dleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladq
    ctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsi
    ltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgal
    nvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdpr
    hgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpggdl
    akvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaal
    ekdyeevgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x1iB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1iB (B:)
    eivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvpr
    ailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrk
    esescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvvep
    ynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclrf
    pgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaa
    cdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglk
    msatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvsey
    qqyqdata
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x1iC (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1iC (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpddsfntffsetgagkhvpravfv
    dleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladq
    ctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsi
    ltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgal
    nvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdpr
    hgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpggdl
    akvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaal
    ekdyeevgvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x1iD (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1iD (D:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
    pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmma
    acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
    kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
    yqqyqdatad
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4x1iE (E:)
    admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
    qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
    qekdkhaeevrknkelkeeasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1iE (E:)
    ielnkatsgqswevilkppsfdgvpepsleeiqkkleaaeerrkyqeaellkhlaekreh
    ereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknke
    lke