Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
Domain d4x1ye_: 4x1y E: [270806] Other proteins in same PDB: d4x1ya1, d4x1ya2, d4x1yb1, d4x1yb2, d4x1yc1, d4x1yc2, d4x1yd1, d4x1yd2 automated match to d3ryce_ complexed with 3wv, gdp, gtp, loc, mg |
PDB Entry: 4x1y (more details), 3.19 Å
SCOPe Domain Sequences for d4x1ye_:
Sequence, based on SEQRES records: (download)
>d4x1ye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} ielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqeael lkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdk haeevrknkelke
>d4x1ye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} ielnkatsgqswevilkppsfdgvpepsleeiqkkleaaeerrkyqeaellkhlaekreh ereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknke lke
Timeline for d4x1ye_: