PDB entry 4x1y

View 4x1y on RCSB PDB site
Description: Discovery of cytotoxic Dolastatin 10 analogs with N-terminal modifications
Class: Structural Protein/Inhibitor
Keywords: Binding Sites, Competitive, Cattle, Tumor, Colchicine, Humans, Microtubules, Protein Binding, Protein Conformation, Protein Multimerization, Tubulin, Tubulin Modulators, Structural Protein-Inhibitor complex
Deposited on 2014-11-25, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x1ya1, d4x1ya2
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x1yb1, d4x1yb2
  • Chain 'C':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x1yc1, d4x1yc2
  • Chain 'D':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4x1yd1, d4x1yd2
  • Chain 'E':
    Compound: Stathmin-4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STMN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63043
      • engineered mutation (10)
      • engineered mutation (16)
    Domains in SCOPe 2.07: d4x1ye_
  • Heterogens: GTP, MG, GDP, LOC, 3WV

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4x1yA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1yA (A:)
    recisihvgqagvqignacwelyclehgiqpdgqmpsddsfntffsetgagkhvpravfv
    dleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladq
    ctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsi
    ltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgal
    nvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdpr
    hgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpggdl
    akvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaal
    ekdyeevgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4x1yB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1yB (B:)
    eivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvpr
    ailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrk
    esescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvvep
    ynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclrf
    pgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaa
    cdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglk
    msatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvsey
    qqyqdata
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4x1yC (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1yC (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpddsfntffsetgagkhvpravfv
    dleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladq
    ctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsi
    ltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgal
    nvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdpr
    hgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpggdl
    akvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaal
    ekdyeevgvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4x1yD (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1yD (D:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
    pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmma
    acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
    kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
    yqqyqdatad
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4x1yE (E:)
    admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
    qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
    qekdkhaeevrknkelkeeasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4x1yE (E:)
    ielnkatsgqswevilkppsfdgvpepsleeiqkkleaaeerrkyqeaellkhlaekreh
    ereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknke
    lke