SCOPe 2.08: Domain d4x1yd2: 4x1y D:246-441

Lineage for d4x1yd2 (4x1y D:246-441)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)

8. Domain d4x1yd2: 4x1y D:246-441 [270805]
   Other proteins in same PDB: d4x1ya1, d4x1yb1, d4x1yc1, d4x1yd1, d4x1ye_
   automated match to d3rycd2
   complexed with 3wv, gdp, gtp, loc, mg

Details for d4x1yd2

PDB Entry: 4x1y, 3.19 Å

PDB Description: discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d4x1yd2:

Sequence; same for both SEQRES and ATOM records:

>d4x1yd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Timeline for d4x1yd2:

• d4x1yd2 first appeared in SCOPe 2.05
  
• d4x1yd2 appears in SCOPe 2.07