Lineage for d4x1yd2 (4x1y D:246-441)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959964Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)
  8. 2960014Domain d4x1yd2: 4x1y D:246-441 [270805]
    Other proteins in same PDB: d4x1ya1, d4x1yb1, d4x1yc1, d4x1yd1, d4x1ye_
    automated match to d3rycd2
    complexed with 3wv, gdp, gtp, loc, mg

Details for d4x1yd2

PDB Entry: 4x1y (more details), 3.19 Å

PDB Description: discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d4x1yd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x1yd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d4x1yd2:

Click to download the PDB-style file with coordinates for d4x1yd2.
(The format of our PDB-style files is described here.)

Timeline for d4x1yd2: