![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (9 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries) |
![]() | Domain d4x1yb1: 4x1y B:3-245 [270796] Other proteins in same PDB: d4x1ya2, d4x1yb2, d4x1yc2, d4x1yd2, d4x1ye_ automated match to d4drxb1 complexed with 3wv, gdp, gtp, loc, mg |
PDB Entry: 4x1y (more details), 3.19 Å
SCOPe Domain Sequences for d4x1yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x1yb1 c.32.1.1 (B:3-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]} eivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvpr ailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrk esescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvvep ynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclrf p
Timeline for d4x1yb1: