SCOPe 2.08: Domain d4x1yd1: 4x1y D:2-245

Lineage for d4x1yd1 (4x1y D:2-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries)

8. Domain d4x1yd1: 4x1y D:2-245 [270804]
   Other proteins in same PDB: d4x1ya2, d4x1yb2, d4x1yc2, d4x1yd2, d4x1ye_
   automated match to d4drxb1
   complexed with 3wv, gdp, gtp, loc, mg

Details for d4x1yd1

PDB Entry: 4x1y, 3.19 Å

PDB Description: discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d4x1yd1:

Sequence; same for both SEQRES and ATOM records:

>d4x1yd1 c.32.1.1 (D:2-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d4x1yd1:

• d4x1yd1 first appeared in SCOPe 2.05
  
• d4x1yd1 appears in SCOPe 2.07