Lineage for d4xl1a2 (4xl1 A:453-491)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258773Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2258774Protein automated matches [226968] (4 species)
    not a true protein
  7. 2258833Species Norway rat (Rattus norvegicus) [TaxId:10116] [270149] (4 PDB entries)
  8. 2258835Domain d4xl1a2: 4xl1 A:453-491 [270154]
    Other proteins in same PDB: d4xl1a4, d4xl1d4, d4xl1d5
    automated match to d4d0fa2
    complexed with bgc, ca, fuc, nag

Details for d4xl1a2

PDB Entry: 4xl1 (more details), 2.3 Å

PDB Description: complex of notch1 (egf11-13) bound to delta-like 4 (n-egf1)
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d4xl1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xl1a2 g.3.11.0 (A:453-491) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vnecisnpcqndatcldqigefqcicmpgyegvyceint

SCOPe Domain Coordinates for d4xl1a2:

Click to download the PDB-style file with coordinates for d4xl1a2.
(The format of our PDB-style files is described here.)

Timeline for d4xl1a2: