SCOPe 2.06: Domain d4xl1a1: 4xl1 A:414-452

Lineage for d4xl1a1 (4xl1 A:414-452)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [270149] (4 PDB entries)

8. Domain d4xl1a1: 4xl1 A:414-452 [270153]
   Other proteins in same PDB: d4xl1a4, d4xl1d4, d4xl1d5
   automated match to d4d0fa1
   complexed with bgc, ca, fuc, nag

Details for d4xl1a1

PDB Entry: 4xl1, 2.3 Å

PDB Description: complex of notch1 (egf11-13) bound to delta-like 4 (n-egf1)

PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d4xl1a1:

Sequence; same for both SEQRES and ATOM records:

>d4xl1a1 g.3.11.0 (A:414-452) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
decalganpcehagkclntlgsfecqclqgytgprceid

Timeline for d4xl1a1:

• d4xl1a1 first appeared in SCOPe 2.05
  
• d4xl1a1 appears in SCOPe 2.07
  
• d4xl1a1 appears in the current release, SCOPe 2.08