Lineage for d4xl1a1 (4xl1 A:414-452)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961820Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 1961821Protein automated matches [226968] (3 species)
    not a true protein
  7. 1961868Species Rattus norvegicus [TaxId:10116] [270149] (1 PDB entry)
  8. 1961869Domain d4xl1a1: 4xl1 A:414-452 [270153]
    automated match to d4d0fa1
    complexed with bgc, ca, fuc, nag

Details for d4xl1a1

PDB Entry: 4xl1 (more details), 2.3 Å

PDB Description: complex of notch1 (egf11-13) bound to delta-like 4 (n-egf1)
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d4xl1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xl1a1 g.3.11.0 (A:414-452) automated matches {Rattus norvegicus [TaxId: 10116]}
decalganpcehagkclntlgsfecqclqgytgprceid

SCOPe Domain Coordinates for d4xl1a1:

Click to download the PDB-style file with coordinates for d4xl1a1.
(The format of our PDB-style files is described here.)

Timeline for d4xl1a1: