SCOPe 2.05: Domain d4xl1a2: 4xl1 A:453-491

Lineage for d4xl1a2 (4xl1 A:453-491)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (3 species)
   not a true protein

7. Species Rattus norvegicus [TaxId:10116] [270149] (1 PDB entry)

8. Domain d4xl1a2: 4xl1 A:453-491 [270154]
   automated match to d4d0fa2
   complexed with bgc, ca, fuc, nag

Details for d4xl1a2

PDB Entry: 4xl1, 2.3 Å

PDB Description: complex of notch1 (egf11-13) bound to delta-like 4 (n-egf1)

PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d4xl1a2:

Sequence; same for both SEQRES and ATOM records:

>d4xl1a2 g.3.11.0 (A:453-491) automated matches {Rattus norvegicus [TaxId: 10116]}
vnecisnpcqndatcldqigefqcicmpgyegvyceint

Timeline for d4xl1a2:

• d4xl1a2 is new in SCOPe 2.05-stable
  
• d4xl1a2 appears in SCOPe 2.06
  
• d4xl1a2 appears in the current release, SCOPe 2.08