PDB entry 4xl1
View 4xl1 on RCSB PDB site
Description: Complex of Notch1 (EGF11-13) bound to Delta-like 4 (N-EGF1)
Class: protein binding
Keywords: glycosylation, EGF domains, receptor-ligand complex, PROTEIN BINDING
Deposited on
2015-01-13, released
2015-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated
2015-03-11, with a file datestamp of
2015-03-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Neurogenic locus notch homolog protein 1
Species: Rattus norvegicus [TaxId:10116]
Gene: Notch1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4xl1a1, d4xl1a2, d4xl1a3, d4xl1a4 - Chain 'B':
Compound: Delta-like protein
Species: Rattus norvegicus [TaxId:10116]
Gene: Dll4, Dll4_predicted, rCG_26804
Database cross-references and differences (RAF-indexed):
- Uniprot D3ZHH1 (2-227)
- expression tag (1)
- engineered mutation (3)
- engineered mutation (82)
- engineered mutation (181)
- expression tag (228-229)
- Chain 'D':
Compound: Neurogenic locus notch homolog protein 1
Species: Rattus norvegicus [TaxId:10116]
Gene: Notch1
Database cross-references and differences (RAF-indexed):
- Uniprot Q07008 (1-115)
- expression tag (0)
- expression tag (116)
Domains in SCOPe 2.06: d4xl1d1, d4xl1d2, d4xl1d3, d4xl1d4, d4xl1d5 - Chain 'E':
Compound: Delta-like protein
Species: Rattus norvegicus [TaxId:10116]
Gene: Dll4, Dll4_predicted, rCG_26804
Database cross-references and differences (RAF-indexed):
- Uniprot D3ZHH1 (2-227)
- expression tag (0-1)
- engineered mutation (3)
- engineered mutation (82)
- engineered mutation (181)
- expression tag (228)
- Heterogens: BGC, FUC, CA, NAG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4xl1A (A:)
pdvdecalganpcehagkclntlgsfecqclqgytgprceidvnecisnpcqndatcldq
igefqcicmpgyegvyceintdecasspclhngrcvdkineflcqcpkgfsghlcqsg
Sequence, based on observed residues (ATOM records): (download)
>4xl1A (A:)
decalganpcehagkclntlgsfecqclqgytgprceidvnecisnpcqndatcldqige
fqcicmpgyegvyceintdecasspclhngrcvdkineflcqcpkgfsghlcqsg
- Chain 'B':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>4xl1D (D:)
pdvdecalganpcehagkclntlgsfecqclqgytgprceidvnecisnpcqndatcldq
igefqcicmpgyegvyceintdecasspclhngrcvdkineflcqcpkgfsghlcqsg
Sequence, based on observed residues (ATOM records): (download)
>4xl1D (D:)
pdvdecalganpcehagkclntlgsfecqclqgytgprceidvnecisnpcqndatcldq
igefqcicmpgyegvyceintdecasspclhngrcvdkineflcqcpkgfsghlcqs
- Chain 'E':
No sequence available.