PDB entry 4xl1

View 4xl1 on RCSB PDB site
Description: Complex of Notch1 (EGF11-13) bound to Delta-like 4 (N-EGF1)
Class: protein binding
Keywords: glycosylation, EGF domains, receptor-ligand complex, PROTEIN BINDING
Deposited on 2015-01-13, released 2015-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Notch1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07008 (Start-115)
      • expression tag (116-117)
    Domains in SCOPe 2.06: d4xl1a1, d4xl1a2, d4xl1a3, d4xl1a4
  • Chain 'B':
    Compound: Delta-like protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dll4, Dll4_predicted, rCG_26804
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3ZHH1 (2-227)
      • expression tag (1)
      • engineered mutation (3)
      • engineered mutation (82)
      • engineered mutation (181)
      • expression tag (228-229)
  • Chain 'D':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Notch1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07008 (1-115)
      • expression tag (0)
      • expression tag (116)
    Domains in SCOPe 2.06: d4xl1d1, d4xl1d2, d4xl1d3, d4xl1d4, d4xl1d5
  • Chain 'E':
    Compound: Delta-like protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dll4, Dll4_predicted, rCG_26804
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3ZHH1 (2-227)
      • expression tag (0-1)
      • engineered mutation (3)
      • engineered mutation (82)
      • engineered mutation (181)
      • expression tag (228)
  • Heterogens: BGC, FUC, CA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xl1A (A:)
    pdvdecalganpcehagkclntlgsfecqclqgytgprceidvnecisnpcqndatcldq
    igefqcicmpgyegvyceintdecasspclhngrcvdkineflcqcpkgfsghlcqsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xl1A (A:)
    decalganpcehagkclntlgsfecqclqgytgprceidvnecisnpcqndatcldqige
    fqcicmpgyegvyceintdecasspclhngrcvdkineflcqcpkgfsghlcqsg
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xl1D (D:)
    pdvdecalganpcehagkclntlgsfecqclqgytgprceidvnecisnpcqndatcldq
    igefqcicmpgyegvyceintdecasspclhngrcvdkineflcqcpkgfsghlcqsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xl1D (D:)
    pdvdecalganpcehagkclntlgsfecqclqgytgprceidvnecisnpcqndatcldq
    igefqcicmpgyegvyceintdecasspclhngrcvdkineflcqcpkgfsghlcqs
    

  • Chain 'E':
    No sequence available.