Lineage for d4d0fa2 (4d0f A:453-491)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258773Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2258774Protein automated matches [226968] (4 species)
    not a true protein
  7. 2258775Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries)
  8. 2258822Domain d4d0fa2: 4d0f A:453-491 [256763]
    Other proteins in same PDB: d4d0fa4, d4d0fa5
    automated match to d1toza2
    complexed with ca, edo; mutant

Details for d4d0fa2

PDB Entry: 4d0f (more details), 2.8 Å

PDB Description: human notch1 egf domains 11-13 mutant t466a
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d4d0fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d0fa2 g.3.11.0 (A:453-491) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnecvsnpcqndaacldqigefqcicmpgyegvhcevnt

SCOPe Domain Coordinates for d4d0fa2:

Click to download the PDB-style file with coordinates for d4d0fa2.
(The format of our PDB-style files is described here.)

Timeline for d4d0fa2: