SCOP 1.61: Domain d1foec2: 1foe C:1240-1401

Lineage for d1foec2 (1foe C:1240-1401)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.55: PH domain-like [50728] (1 superfamily)
Superfamily b.55.1: PH domain-like [50729] (5 families)
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (14 proteins)
Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) [50745] (1 species)
Species Mouse (Mus musculus) [TaxId:10090] [50746] (1 PDB entry)
Domain d1foec2: 1foe C:1240-1401 [26970]
Other proteins in same PDB: d1foea1, d1foeb_, d1foec1, d1foed_, d1foee1, d1foef_, d1foeg1, d1foeh_

Details for d1foec2

PDB Entry: 1foe (more details), 2.8 Å

PDB Description: crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1

SCOP Domain Sequences for d1foec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foec2 b.55.1.1 (C:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) {Mouse (Mus musculus)}
efgavfdqliaeqtgekkevadlsmgdlllhtsviwlnppaslgkwkkepelaafvfkta
vvlvykdgskqkkklvgshrlsiyeewdpfrfrhmiptealqvralpsadaeanavceiv
hvksesegrpervfhlccsspesrkdflksvhsilrdkhrrq

SCOP Domain Coordinates for d1foec2:

Click to download the PDB-style file with coordinates for d1foec2.
(The format of our PDB-style files is described here.)

Timeline for d1foec2: