SCOPe 2.08: Domain d1foec2: 1foe C:1240-1401

Lineage for d1foec2 (1foe C:1240-1401)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) [50745] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50746] (1 PDB entry)

8. Domain d1foec2: 1foe C:1240-1401 [26970]
   Other proteins in same PDB: d1foea1, d1foeb_, d1foec1, d1foed_, d1foee1, d1foef_, d1foeg1, d1foeh_
   complexed with so4
   has additional insertions and/or extensions that are not grouped together

Details for d1foec2

PDB Entry: 1foe, 2.8 Å

PDB Description: crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1

PDB Compounds: (C:) t-lymphoma invasion and metastasis inducing protein 1

SCOPe Domain Sequences for d1foec2:

Sequence; same for both SEQRES and ATOM records:

>d1foec2 b.55.1.1 (C:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]}
efgavfdqliaeqtgekkevadlsmgdlllhtsviwlnppaslgkwkkepelaafvfkta
vvlvykdgskqkkklvgshrlsiyeewdpfrfrhmiptealqvralpsadaeanavceiv
hvksesegrpervfhlccsspesrkdflksvhsilrdkhrrq

Timeline for d1foec2:

• d1foec2 first appeared (with stable ids) in SCOP 1.55
  
• d1foec2 appears in SCOPe 2.07