Class a: All alpha proteins [46456] (151 folds) |
Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily) |
Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) |
Family a.87.1.1: DBL homology domain (DH-domain) [48066] (6 proteins) |
Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) [48073] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48074] (1 PDB entry) |
Domain d1foeg1: 1foe G:1035-1239 [18520] Other proteins in same PDB: d1foea2, d1foeb_, d1foec2, d1foed_, d1foee2, d1foef_, d1foeg2, d1foeh_ |
PDB Entry: 1foe (more details), 2.8 Å
SCOP Domain Sequences for d1foeg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1foeg1 a.87.1.1 (G:1035-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) {Mouse (Mus musculus)} lsdadklrkvicelletertyvkdlnclmerylkplqketfltqdeldvlfgnltemvef qveflktledgvrlvpdleklekvdqfkkvlfslggsflyyadrfklysafcashtkvpk vlvkaktdtafkafldaqnprqqhsstlesylikpiqrvlkyplllrelfaltdaeseeh yhldvaiktmnkvashinemqkihe
Timeline for d1foeg1: