Lineage for d1foeg2 (1foe G:1240-1401)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169555Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 169556Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 169557Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (14 proteins)
  6. 169599Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) [50745] (1 species)
  7. 169600Species Mouse (Mus musculus) [TaxId:10090] [50746] (1 PDB entry)
  8. 169604Domain d1foeg2: 1foe G:1240-1401 [26972]
    Other proteins in same PDB: d1foea1, d1foeb_, d1foec1, d1foed_, d1foee1, d1foef_, d1foeg1, d1foeh_

Details for d1foeg2

PDB Entry: 1foe (more details), 2.8 Å

PDB Description: crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1

SCOP Domain Sequences for d1foeg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foeg2 b.55.1.1 (G:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) {Mouse (Mus musculus)}
efgavfdqliaeqtgekkevadlsmgdlllhtsviwlnppaslgkwkkepelaafvfkta
vvlvykdgskqkkklvgshrlsiyeewdpfrfrhmiptealqvralpsadaeanavceiv
hvksesegrpervfhlccsspesrkdflksvhsilrdkhrrq

SCOP Domain Coordinates for d1foeg2:

Click to download the PDB-style file with coordinates for d1foeg2.
(The format of our PDB-style files is described here.)

Timeline for d1foeg2: