SCOP 1.55: Domain d1foec2: 1foe C:1240-1401

Lineage for d1foec2 (1foe C:1240-1401)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)

4. Superfamily b.55.1: PH domain-like [50729] (5 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (11 proteins)

6. Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) [50745] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50746] (1 PDB entry)

8. Domain d1foec2: 1foe C:1240-1401 [26970]
   Other proteins in same PDB: d1foea1, d1foeb_, d1foec1, d1foed_, d1foee1, d1foef_, d1foeg1, d1foeh_

Details for d1foec2

PDB Entry: 1foe, 2.8 Å

PDB Description: crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1

SCOP Domain Sequences for d1foec2:

Sequence; same for both SEQRES and ATOM records:

>d1foec2 b.55.1.1 (C:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis indusing protein 1) {Mouse (Mus musculus)}
efgavfdqliaeqtgekkevadlsmgdlllhtsviwlnppaslgkwkkepelaafvfkta
vvlvykdgskqkkklvgshrlsiyeewdpfrfrhmiptealqvralpsadaeanavceiv
hvksesegrpervfhlccsspesrkdflksvhsilrdkhrrq

Timeline for d1foec2:

• d1foec2 appears in SCOP 1.57
  
• d1foec2 appears in the current release, SCOPe 2.08