SCOPe 2.08: Domain d1b55b_: 1b55 B:

Lineage for d1b55b_ (1b55 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Bruton's tyrosine kinase [50738] (1 species)
   contains Btk zinc-binding motif

7. Species Human (Homo sapiens) [TaxId:9606] [50739] (10 PDB entries)

8. Domain d1b55b_: 1b55 B: [26964]
   complexed with 4ip, zn
   has additional insertions and/or extensions that are not grouped together

Details for d1b55b_

PDB Entry: 1b55, 2.4 Å

PDB Description: ph domain from bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate

PDB Compounds: (B:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d1b55b_:

Sequence, based on SEQRES records:

>d1b55b_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Sequence, based on observed residues (ATOM records):

>d1b55b_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqisemeqisiierfpypfqvvydegplyvfspteelrkrwihql
knvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Timeline for d1b55b_:

• d1b55b_ first appeared (with stable ids) in SCOP 1.55
  
• d1b55b_ appears in SCOPe 2.07