PDB entry 1b55

View 1b55 on RCSB PDB site
Description: ph domain from bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate
Class: transferase
Keywords: transferase, ph domain, btk motif, zinc binding, x-linked agammaglobulinemia, tyrosine-protein kinase, inositol 1,3,4,5-tetrakisphosphate
Deposited on 1999-01-12, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b55a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b55b_
  • Heterogens: ZN, 4IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b55A (A:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
    krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b55A (A:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrmeqisiierfpypfqvvydegplyvfspteelrkrwihq
    lknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b55B (B:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
    krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b55B (B:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqisemeqisiierfpypfqvvydegplyvfspteelrkrwihql
    knvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen