Lineage for d1b55a_ (1b55 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2061578Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 protein domains)
    Pfam PF00169
  6. 2061598Protein Bruton's tyrosine kinase [50738] (1 species)
    contains Btk zinc-binding motif
  7. 2061599Species Human (Homo sapiens) [TaxId:9606] [50739] (3 PDB entries)
  8. 2061604Domain d1b55a_: 1b55 A: [26963]
    complexed with 4ip, zn

Details for d1b55a_

PDB Entry: 1b55 (more details), 2.4 Å

PDB Description: ph domain from bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d1b55a_:

Sequence, based on SEQRES records: (download)

>d1b55a_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Sequence, based on observed residues (ATOM records): (download)

>d1b55a_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrmeqisiierfpypfqvvydegplyvfspteelrkrwihq
lknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

SCOPe Domain Coordinates for d1b55a_:

Click to download the PDB-style file with coordinates for d1b55a_.
(The format of our PDB-style files is described here.)

Timeline for d1b55a_: