Lineage for d1qa7d_ (1qa7 D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 15589Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (2 proteins)
  6. 15594Protein 3C cysteine protease (picornain 3C) [50604] (2 species)
  7. 15595Species Human hepatitis A virus [TaxId:208726] [50606] (2 PDB entries)
  8. 15601Domain d1qa7d_: 1qa7 D: [26428]

Details for d1qa7d_

PDB Entry: 1qa7 (more details), 1.9 Å

PDB Description: crystal complex of the 3c proteinase from hepatitis a virus with its inhibitor and implications for the polyprotein processing in hav

SCOP Domain Sequences for d1qa7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qa7d_ b.47.1.4 (D:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqnidkkie

SCOP Domain Coordinates for d1qa7d_:

Click to download the PDB-style file with coordinates for d1qa7d_.
(The format of our PDB-style files is described here.)

Timeline for d1qa7d_: