Lineage for d1qa7d_ (1qa7 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797308Protein 3C cysteine protease (picornain 3C) [50604] (9 species)
  7. 2797341Species Human hepatitis A virus [TaxId:208726] [50606] (5 PDB entries)
  8. 2797348Domain d1qa7d_: 1qa7 D: [26428]
    complexed with dms, gol, ivf

Details for d1qa7d_

PDB Entry: 1qa7 (more details), 1.9 Å

PDB Description: crystal complex of the 3c proteinase from hepatitis a virus with its inhibitor and implications for the polyprotein processing in hav
PDB Compounds: (D:) hav 3c proteinase

SCOPe Domain Sequences for d1qa7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qa7d_ b.47.1.4 (D:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqnidkkie

SCOPe Domain Coordinates for d1qa7d_:

Click to download the PDB-style file with coordinates for d1qa7d_.
(The format of our PDB-style files is described here.)

Timeline for d1qa7d_: