![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (2 proteins) |
![]() | Protein 3C cysteine protease (picornain 3C) [50604] (2 species) |
![]() | Species Human hepatitis A virus [TaxId:208726] [50606] (2 PDB entries) |
![]() | Domain d1qa7c_: 1qa7 C: [26427] |
PDB Entry: 1qa7 (more details), 1.9 Å
SCOP Domain Sequences for d1qa7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qa7c_ b.47.1.4 (C:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus} stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn qsiqnailgihvaggnsilvaklvtqemfqnid
Timeline for d1qa7c_: