| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) ![]() |
| Family f.6.1.0: automated matches [227293] (1 protein) not a true family |
| Protein automated matches [227114] (5 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158878] [259901] (2 PDB entries) |
| Domain d4p1xh_: 4p1x H: [263415] Other proteins in same PDB: d4p1xa_, d4p1xc_, d4p1xe_, d4p1xg_ automated match to d4iyca_ complexed with mpd |
PDB Entry: 4p1x (more details), 2.4 Å
SCOPe Domain Sequences for d4p1xh_:
Sequence, based on SEQRES records: (download)
>d4p1xh_ f.6.1.0 (H:) automated matches {Staphylococcus aureus [TaxId: 158878]}
dieiikrtedktsnkwgvtqniqfdfvkdkkynkdalilkmqgfissrttyynykktnhv
kamrwpfqyniglktndkyvslinylpknkiestnvsqtlgyniggnfqsapslggngsf
nysksisytqqnyvseveqqnsksvlwgvkansfatesgqksafdsdlfvgykphskdpr
dyfvpdselpplvqsgfnpsfiatvshekgssdtsefeitygrnmdvthaikrsthygns
yldghrvhnafvnrnytvkyevnwktheikvkgqn
>d4p1xh_ f.6.1.0 (H:) automated matches {Staphylococcus aureus [TaxId: 158878]}
dieiikrtedktsnkwgvtqniqfdfvkdkkynkdalilkmqgfissrttyynykktnhv
kamrwpfqyniglktndkyvslinylpknkiestnvsqtlgynisfnysksisytqqnyv
seveqqnsksvlwgvkansfatesgqksafdsdlfvgykphskdprdyfvpdselpplvq
sgfnpsfiatvshekgssdtsefeitygrnmdvthaikrsgnsyldghrvhnafvnrnyt
vkyevnwktheikvkgqn
Timeline for d4p1xh_: