Lineage for d4p1xd_ (4p1x D:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251912Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 2251913Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 2252040Family f.6.1.0: automated matches [227293] (1 protein)
    not a true family
  6. 2252041Protein automated matches [227114] (5 species)
    not a true protein
  7. 2252045Species Staphylococcus aureus [TaxId:158878] [259901] (2 PDB entries)
  8. 2252047Domain d4p1xd_: 4p1x D: [259903]
    Other proteins in same PDB: d4p1xa_, d4p1xc_, d4p1xe_, d4p1xg_
    automated match to d4iyca_
    complexed with mpd

Details for d4p1xd_

PDB Entry: 4p1x (more details), 2.4 Å

PDB Description: Crystal structure of staphylococcal LUK prepore
PDB Compounds: (D:) Gamma-hemolysin component C

SCOPe Domain Sequences for d4p1xd_:

Sequence, based on SEQRES records: (download)

>d4p1xd_ f.6.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158878]}
dieiikrtedktsnkwgvtqniqfdfvkdkkynkdalilkmqgfissrttyynykktnhv
kamrwpfqyniglktndkyvslinylpknkiestnvsqtlgyniggnfqsapslggngsf
nysksisytqqnyvseveqqnsksvlwgvkansfatesgqksafdsdlfvgykphskdpr
dyfvpdselpplvqsgfnpsfiatvshekgssdtsefeitygrnmdvthaikrsthygns
yldghrvhnafvnrnytvkyevnwktheikvkgqn

Sequence, based on observed residues (ATOM records): (download)

>d4p1xd_ f.6.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158878]}
dieiikrtedktsnkwgvtqniqfdfvkdkkynkdalilkmqgfissrttyynykktnhv
kamrwpfqyniglktndkyvslinylpknkiestnvsqtlgynisfnysksisytqqnyv
seveqqnsksvlwgvkansfatesgqksafdsdlfvgykphskdprdyfvpdselpplvq
sgfnpsfiatvshekgssdtsefeitygrnmdvthaikrsnsyldghrvhnafvnrnytv
kyevnwktheikvkgqn

SCOPe Domain Coordinates for d4p1xd_:

Click to download the PDB-style file with coordinates for d4p1xd_.
(The format of our PDB-style files is described here.)

Timeline for d4p1xd_: