Lineage for d4p1xc_ (4p1x C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251912Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 2251913Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 2251914Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 2251979Protein automated matches [190904] (3 species)
    not a true protein
  7. 2251980Species Staphylococcus aureus [TaxId:158878] [189747] (5 PDB entries)
  8. 2252008Domain d4p1xc_: 4p1x C: [260347]
    Other proteins in same PDB: d4p1xb_, d4p1xd_, d4p1xf_, d4p1xh_
    automated match to d3lkfa_
    complexed with mpd

Details for d4p1xc_

PDB Entry: 4p1x (more details), 2.4 Å

PDB Description: Crystal structure of staphylococcal LUK prepore
PDB Compounds: (C:) Gamma-hemolysin component B

SCOPe Domain Sequences for d4p1xc_:

Sequence, based on SEQRES records: (download)

>d4p1xc_ f.6.1.1 (C:) automated matches {Staphylococcus aureus [TaxId: 158878]}
vtlykttatadsdkfkisqiltfnfikdksydkdtlvlkatgninsgfvkpnpndydfsk
lywgakynvsissqsndsvnvvdyapknqneefqvqntlgytfggdisisnglsgglngn
tafsetinykqesyrttlsrntnyknvgwgveahkimnngwgpygrdsfhptygnelfla
grqssayagqnfiaqhqmpllsrsnfnpeflsvlshrqdgakkskitvtyqremdlyqir
wngfywaganyknfktrtfkstyeidwenhkvklldtketennk

Sequence, based on observed residues (ATOM records): (download)

>d4p1xc_ f.6.1.1 (C:) automated matches {Staphylococcus aureus [TaxId: 158878]}
vtlykttatadsdkfkisqiltfnfikdksydkdtlvlkatgninsgfvkpnpndydfsk
lywgakynvsissqsndsvnvvdyapknqneefqvqntlgytntafsetinykqesyrtt
lsrntnyknvgwgveahkimnngwgpygrdsfhptygnelflagrqssayagqnfiaqhq
mpllsrsnfnpeflsvlshrqdgakkskitvtyqremdlyqirwngfywaganyknfktr
tfkstyeidwenhkvklldtketennk

SCOPe Domain Coordinates for d4p1xc_:

Click to download the PDB-style file with coordinates for d4p1xc_.
(The format of our PDB-style files is described here.)

Timeline for d4p1xc_: