Lineage for d4iyca_ (4iyc A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251912Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 2251913Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 2252040Family f.6.1.0: automated matches [227293] (1 protein)
    not a true family
  6. 2252041Protein automated matches [227114] (5 species)
    not a true protein
  7. 2252076Species Staphylococcus phage [TaxId:71366] [236419] (5 PDB entries)
  8. 2252083Domain d4iyca_: 4iyc A: [236420]
    automated match to d3lkfa_
    mutant

Details for d4iyca_

PDB Entry: 4iyc (more details), 2.75 Å

PDB Description: structure of the t244a mutant of the panton-valentine leucocidin component from staphylococcus aureus
PDB Compounds: (A:) LukS-PV

SCOPe Domain Sequences for d4iyca_:

Sequence, based on SEQRES records: (download)

>d4iyca_ f.6.1.0 (A:) automated matches {Staphylococcus phage [TaxId: 71366]}
nnienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyy
nykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgp
stggngsfnysktisynqqnyisevehqnsksvqwgikansfitslgkmsghdpnlfvgy
kpysqnprdyfvpdnelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatr
rtahygnsylegsrihnafvnrnytvkyevnwktheikvkghn

Sequence, based on observed residues (ATOM records): (download)

>d4iyca_ f.6.1.0 (A:) automated matches {Staphylococcus phage [TaxId: 71366]}
nnienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyy
nykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgp
gngsfnysktisynqqnyisevehqnsksvqwgikansfitslgkmsghdpnlfvgykpy
sqnprdyfvpdnelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatrrtg
nsylegsrihnafvnrnytvkyevnwktheikvkghn

SCOPe Domain Coordinates for d4iyca_:

Click to download the PDB-style file with coordinates for d4iyca_.
(The format of our PDB-style files is described here.)

Timeline for d4iyca_: