![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
![]() | Protein DNA polymerase lambda [101251] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries) |
![]() | Domain d4k4gm1: 4k4g M:249-328 [262797] Other proteins in same PDB: d4k4ga2, d4k4ga3, d4k4ga4, d4k4ge2, d4k4ge3, d4k4ge4, d4k4gi2, d4k4gi3, d4k4gi4, d4k4gm2, d4k4gm3, d4k4gm4 automated match to d3hw8a1 protein/DNA complex; complexed with 1s0, act, ca, cac |
PDB Entry: 4k4g (more details), 2.15 Å
SCOPe Domain Sequences for d4k4gm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k4gm1 a.60.6.1 (M:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr maekiieilesghlrkldhi
Timeline for d4k4gm1: