Lineage for d4k4gm1 (4k4g M:249-328)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1737967Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1737968Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1738136Protein DNA polymerase lambda [101251] (1 species)
  7. 1738137Species Human (Homo sapiens) [TaxId:9606] [101252] (27 PDB entries)
  8. 1738178Domain d4k4gm1: 4k4g M:249-328 [262797]
    Other proteins in same PDB: d4k4ga2, d4k4ga3, d4k4ge2, d4k4ge3, d4k4gi2, d4k4gi3, d4k4gm2, d4k4gm3
    automated match to d3hw8a1
    protein/DNA complex; complexed with 1s0, act, ca, cac

Details for d4k4gm1

PDB Entry: 4k4g (more details), 2.15 Å

PDB Description: ternary crystal structures of human dna polymerase lambda in complex with dna and l-dctp.
PDB Compounds: (M:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4gm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4gm1 a.60.6.1 (M:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

SCOPe Domain Coordinates for d4k4gm1:

Click to download the PDB-style file with coordinates for d4k4gm1.
(The format of our PDB-style files is described here.)

Timeline for d4k4gm1: