Lineage for d4k4ga3 (4k4g A:386-575)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2563573Family d.218.1.2: DNA polymerase beta-like [81300] (5 protein domains)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2563751Protein DNA polymerase lambda [102943] (1 species)
  7. 2563752Species Human (Homo sapiens) [TaxId:9606] [102944] (27 PDB entries)
  8. 2563773Domain d4k4ga3: 4k4g A:386-575 [257798]
    Other proteins in same PDB: d4k4ga1, d4k4ga2, d4k4ga4, d4k4ge1, d4k4ge2, d4k4ge4, d4k4gi1, d4k4gi2, d4k4gi4, d4k4gm1, d4k4gm2, d4k4gm4
    automated match to d1rzta3
    protein/DNA complex; complexed with 1s0, act, ca, cac

Details for d4k4ga3

PDB Entry: 4k4g (more details), 2.15 Å

PDB Description: ternary crystal structures of human dna polymerase lambda in complex with dna and l-dctp.
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4ga3:

Sequence, based on SEQRES records: (download)

>d4k4ga3 d.218.1.2 (A:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally
ftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllgl
pyrepaerdw

Sequence, based on observed residues (ATOM records): (download)

>d4k4ga3 d.218.1.2 (A:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally
ftgsahfnrsmralaktkgmslsehalstavvpgrvlptptekdvfrllglpyrepaerd
w

SCOPe Domain Coordinates for d4k4ga3:

Click to download the PDB-style file with coordinates for d4k4ga3.
(The format of our PDB-style files is described here.)

Timeline for d4k4ga3: