SCOP 1.55: Domain d1tbq.2: 1tbq J:,K:

Lineage for d1tbq.2 (1tbq J:,K:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (18 PDB entries)

8. Domain d1tbq.2: 1tbq J:,K: [26220]
   Other proteins in same PDB: d1tbqr1, d1tbqr2, d1tbqs1, d1tbqs2

Details for d1tbq.2

PDB Entry: 1tbq, 3.1 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

SCOP Domain Sequences for d1tbq.2:

Sequence; same for both SEQRES and ATOM records:

>g1tbq.2 b.47.1.2 (J:,K:) Thrombin {Cow (Bos taurus)}
tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevg
lspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtr
yerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakll
hagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagy
kpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwi
qkvidrlgs

Timeline for d1tbq.2:

• d1tbq.2 appears in SCOP 1.57
  
• d1tbq.2 appears in the current release, SCOPe 2.08