Lineage for d1tbq.2 (1tbq J:,K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795761Protein Thrombin [50531] (2 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
    Uniprot P00734 333-622
  8. 2795784Domain d1tbq.2: 1tbq J:,K: [26220]
    Other proteins in same PDB: d1tbqr1, d1tbqr2, d1tbqs1, d1tbqs2

Details for d1tbq.2

PDB Entry: 1tbq (more details), 3.1 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
PDB Compounds: (J:) thrombin, (K:) thrombin

SCOPe Domain Sequences for d1tbq.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1tbq.2 b.47.1.2 (J:,K:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevg
lspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtr
yerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakll
hagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagy
kpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwi
qkvidrlgs

SCOPe Domain Coordinates for d1tbq.2:

Click to download the PDB-style file with coordinates for d1tbq.2.
(The format of our PDB-style files is described here.)

Timeline for d1tbq.2: