Lineage for d1tbqs2 (1tbq S:52-103)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40708Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 40709Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 40710Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)
  6. 40753Protein Rhodniin [57476] (1 species)
  7. 40754Species Bug (Rhodnius prolixus) [TaxId:13249] [57477] (2 PDB entries)
  8. 40762Domain d1tbqs2: 1tbq S:52-103 [44714]
    Other proteins in same PDB: d1tbq.1, d1tbq.2

Details for d1tbqs2

PDB Entry: 1tbq (more details), 3.1 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

SCOP Domain Sequences for d1tbqs2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbqs2 g.15.1.1 (S:52-103) Rhodniin {Bug (Rhodnius prolixus)}
ededvcqecdgdeykpvcgsdditydnncrlecasissspgvelkhegpcrt

SCOP Domain Coordinates for d1tbqs2:

Click to download the PDB-style file with coordinates for d1tbqs2.
(The format of our PDB-style files is described here.)

Timeline for d1tbqs2: