Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Thrombin [50531] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries) Uniprot P00734 333-622 |
Domain d1ycp.2: 1ycp J:,K:,M: [26215] mutant |
PDB Entry: 1ycp (more details), 2.5 Å
SCOPe Domain Sequences for d1ycp.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ycp.2 b.47.1.2 (J:,K:,M:) Thrombin {Cow (Bos taurus) [TaxId: 9913]} adcglrplfekkqvqdqtekelfesyiegXivegqdaevglspwqvmlfrkspqellcga slisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpry nwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrreXvqp svlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfvmkspynn rwyqmgivswgegcdrdgkygfythvfrlkkwiqkvid
Timeline for d1ycp.2: