| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein automated matches [257263] (1 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [257264] (3 PDB entries) |
| Domain d4q5se_: 4q5s E: [259966] Other proteins in same PDB: d4q5sc_, d4q5sd_, d4q5sf1, d4q5sf2, d4q5sf3 automated match to d1i6ve_ protein/DNA complex; protein/RNA complex; complexed with atp, mg, zn |
PDB Entry: 4q5s (more details), 3 Å
SCOPe Domain Sequences for d4q5se_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q5se_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv
Timeline for d4q5se_: