Lineage for d4q5se_ (4q5s E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751602Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1751603Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1751604Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1751644Protein automated matches [257263] (1 species)
    not a true protein
  7. 1751645Species Thermus thermophilus [TaxId:300852] [257264] (3 PDB entries)
  8. 1751648Domain d4q5se_: 4q5s E: [259966]
    Other proteins in same PDB: d4q5sc_, d4q5sd_, d4q5sf1, d4q5sf2, d4q5sf3
    automated match to d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with atp, mg, zn

Details for d4q5se_

PDB Entry: 4q5s (more details), 3 Å

PDB Description: Thermus thermophilus RNA polymerase initially transcribing complex containing 6-mer RNA
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d4q5se_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q5se_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

SCOPe Domain Coordinates for d4q5se_:

Click to download the PDB-style file with coordinates for d4q5se_.
(The format of our PDB-style files is described here.)

Timeline for d4q5se_: