SCOPe 2.04: Domain d4q5se_: 4q5s E:

Lineage for d4q5se_ (4q5s E:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
   4 helices; irregular array

6. Protein automated matches [257263] (1 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [257264] (3 PDB entries)

8. Domain d4q5se_: 4q5s E: [259966]
   Other proteins in same PDB: d4q5sd_, d4q5sf1, d4q5sf2, d4q5sf3
   automated match to d1i6ve_
   protein/DNA complex; protein/RNA complex; complexed with atp, mg, zn

Details for d4q5se_

PDB Entry: 4q5s, 3 Å

PDB Description: Thermus thermophilus RNA polymerase initially transcribing complex containing 6-mer RNA

PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d4q5se_:

Sequence; same for both SEQRES and ATOM records:

>d4q5se_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

Timeline for d4q5se_:

• d4q5se_ is new in SCOPe 2.04-stable
  
• d4q5se_ appears in SCOPe 2.05
  
• d4q5se_ appears in the current release, SCOPe 2.08