![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.34: PA N-terminal domain [254166] (3 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 |
![]() | Protein PA N-terminal domain [254375] (8 species) |
![]() | Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries) |
![]() | Domain d4nfzc_: 4nfz C: [253951] automated match to d3ebja_ complexed with mn |
PDB Entry: 4nfz (more details), 2.7 Å
SCOPe Domain Sequences for d4nfzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nfzc_ c.52.1.34 (C:) PA N-terminal domain {Influenza A virus [TaxId: 93838]} menfvrtnfnpmileraektmkeygenpqnegnkfaaisthmevcfmysdfhfidlegnt ivkendddnamlkhrfeiiegqerniawtivnsicnmtenskprflpdlydyktnkfiei gvtrrkvedyyyekasklkgenvyihifsfdgeematddeyildeesrariktrlfvlrq elataglwdsfrqsek
Timeline for d4nfzc_: