Lineage for d4nfzc_ (4nfz C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604623Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 1604624Protein PA N-terminal domain [254375] (3 species)
  7. 1604639Species Influenza A virus [TaxId:93838] [254808] (13 PDB entries)
  8. 1604686Domain d4nfzc_: 4nfz C: [253951]
    automated match to d3ebja_
    complexed with mn

Details for d4nfzc_

PDB Entry: 4nfz (more details), 2.7 Å

PDB Description: Crystal structure of polymerase subunit PA N-terminal endonuclease domain from bat-derived influenza virus H17N10
PDB Compounds: (C:) polymerase pa

SCOPe Domain Sequences for d4nfzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nfzc_ c.52.1.34 (C:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
menfvrtnfnpmileraektmkeygenpqnegnkfaaisthmevcfmysdfhfidlegnt
ivkendddnamlkhrfeiiegqerniawtivnsicnmtenskprflpdlydyktnkfiei
gvtrrkvedyyyekasklkgenvyihifsfdgeematddeyildeesrariktrlfvlrq
elataglwdsfrqsek

SCOPe Domain Coordinates for d4nfzc_:

Click to download the PDB-style file with coordinates for d4nfzc_.
(The format of our PDB-style files is described here.)

Timeline for d4nfzc_: