![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries) |
![]() | Domain d4l29o1: 4l29 O:1-181 [253497] Other proteins in same PDB: d4l29a2, d4l29b1, d4l29b2, d4l29c2, d4l29d1, d4l29d2, d4l29e2, d4l29f1, d4l29f2, d4l29g2, d4l29h1, d4l29h2, d4l29i2, d4l29j1, d4l29j2, d4l29k2, d4l29l1, d4l29l2, d4l29m2, d4l29n1, d4l29n2, d4l29o2, d4l29p1, d4l29p2, d4l29q2, d4l29r1, d4l29r2, d4l29s2, d4l29t1, d4l29t2, d4l29u2, d4l29v1, d4l29v2, d4l29w2, d4l29x1, d4l29x2, d4l29y2, d4l29z1, d4l29z2 automated match to d1hlaa2 complexed with cl, gol; mutant |
PDB Entry: 4l29 (more details), 3.09 Å
SCOPe Domain Sequences for d4l29o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l29o1 d.19.1.1 (O:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d4l29o1:
![]() Domains from other chains: (mouse over for more information) d4l29a1, d4l29a2, d4l29b1, d4l29b2, d4l29c1, d4l29c2, d4l29d1, d4l29d2, d4l29e1, d4l29e2, d4l29f1, d4l29f2, d4l29g1, d4l29g2, d4l29h1, d4l29h2, d4l29i1, d4l29i2, d4l29j1, d4l29j2, d4l29k1, d4l29k2, d4l29l1, d4l29l2, d4l29m1, d4l29m2, d4l29n1, d4l29n2, d4l29p1, d4l29p2, d4l29q1, d4l29q2, d4l29r1, d4l29r2, d4l29s1, d4l29s2, d4l29t1, d4l29t2, d4l29u1, d4l29u2, d4l29v1, d4l29v2, d4l29w1, d4l29w2, d4l29x1, d4l29x2, d4l29y1, d4l29y2, d4l29z1, d4l29z2 |