Lineage for d4l29s2 (4l29 S:182-276)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2746845Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2747108Domain d4l29s2: 4l29 S:182-276 [253504]
    Other proteins in same PDB: d4l29a1, d4l29b1, d4l29b2, d4l29c1, d4l29d1, d4l29d2, d4l29e1, d4l29f1, d4l29f2, d4l29g1, d4l29h1, d4l29h2, d4l29i1, d4l29j1, d4l29j2, d4l29k1, d4l29l1, d4l29l2, d4l29m1, d4l29n1, d4l29n2, d4l29o1, d4l29p1, d4l29p2, d4l29q1, d4l29r1, d4l29r2, d4l29s1, d4l29t1, d4l29t2, d4l29u1, d4l29v1, d4l29v2, d4l29w1, d4l29x1, d4l29x2, d4l29y1, d4l29z1, d4l29z2
    automated match to d1ogaa1
    complexed with cl, gol; mutant

Details for d4l29s2

PDB Entry: 4l29 (more details), 3.09 Å

PDB Description: Structure of wtMHC class I with NY-ESO1 double mutant
PDB Compounds: (S:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l29s2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l29s2 b.1.1.2 (S:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d4l29s2:

Click to download the PDB-style file with coordinates for d4l29s2.
(The format of our PDB-style files is described here.)

Timeline for d4l29s2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l29s1
View in 3D
Domains from other chains:
(mouse over for more information)
d4l29a1, d4l29a2, d4l29b1, d4l29b2, d4l29c1, d4l29c2, d4l29d1, d4l29d2, d4l29e1, d4l29e2, d4l29f1, d4l29f2, d4l29g1, d4l29g2, d4l29h1, d4l29h2, d4l29i1, d4l29i2, d4l29j1, d4l29j2, d4l29k1, d4l29k2, d4l29l1, d4l29l2, d4l29m1, d4l29m2, d4l29n1, d4l29n2, d4l29o1, d4l29o2, d4l29p1, d4l29p2, d4l29q1, d4l29q2, d4l29r1, d4l29r2, d4l29t1, d4l29t2, d4l29u1, d4l29u2, d4l29v1, d4l29v2, d4l29w1, d4l29w2, d4l29x1, d4l29x2, d4l29y1, d4l29y2, d4l29z1, d4l29z2