SCOPe 2.08: Domain d4l29w2: 4l29 W:182-276

Lineage for d4l29w2 (4l29 W:182-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d4l29w2: 4l29 W:182-276 [253510]
   Other proteins in same PDB: d4l29a1, d4l29b1, d4l29b2, d4l29c1, d4l29d1, d4l29d2, d4l29e1, d4l29f1, d4l29f2, d4l29g1, d4l29h1, d4l29h2, d4l29i1, d4l29j1, d4l29j2, d4l29k1, d4l29l1, d4l29l2, d4l29m1, d4l29n1, d4l29n2, d4l29o1, d4l29p1, d4l29p2, d4l29q1, d4l29r1, d4l29r2, d4l29s1, d4l29t1, d4l29t2, d4l29u1, d4l29v1, d4l29v2, d4l29w1, d4l29x1, d4l29x2, d4l29y1, d4l29z1, d4l29z2
   automated match to d1ogaa1
   complexed with cl, gol; mutant

Details for d4l29w2

PDB Entry: 4l29, 3.09 Å

PDB Description: Structure of wtMHC class I with NY-ESO1 double mutant

PDB Compounds: (W:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l29w2:

Sequence; same for both SEQRES and ATOM records:

>d4l29w2 b.1.1.2 (W:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

Timeline for d4l29w2:

• d4l29w2 first appeared in SCOPe 2.04
  
• d4l29w2 appears in SCOPe 2.07